missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105964

Invitrogen™ Human RACGAP1 (aa 1-117) Control Fragment Recombinant Protein

Catalog No. RP105964
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105964 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105964 Supplier Invitrogen™ Supplier No. RP105964
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAC, a small GTPase in the ras family, regulates the formation of membrane ruffles, lamellipodia and filopodia. It is involved in cytoskeletal actin organization and transformation. The p21 activated kinases (PAKs) are direct targets of active Rac and Cdc42 which can induce the assembly of polarized cytoskeletal structures when expressed in fibroblasts. RAC1 and RAC2 are also essential components of NADPH oxidase, the enzyme responsible for generating free radicals.

Specifications

Accession Number Q9H0H5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29127
Name Human RACGAP1 (aa 1-117) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI227039; AI327394; AKT; Band25; CYK4; GAP; gtl11; GTPase; HsCYK-4; ID; ID-GAP; KIAA1478; Male germ cell RacGap; MGC99656; MgcRacGAP; mKIAA1478; PKB; PKB-ALPHA; PRKBA; protein CYK4 homolg; Protein CYK4 homolog; RAC; Rac GTPase activating protein 1; Rac GTPase-activating protein 1; RAC-ALPHA; Racgap1
Common Name RACGAP1
Gene Symbol RACGAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less