missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94141

Invitrogen™ Human RAB3GAP2 (aa 192-284) Control Fragment Recombinant Protein

Catalog No. RP94141
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94141 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94141 Supplier Invitrogen™ Supplier No. RP94141

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome.

Specifications

Accession Number Q9H2M9
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 25782
Name Human RAB3GAP2 (aa 192-284) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1110059F07Rik; 2010002H18Rik; 5830469C09; AI851069; AW743433; KIAA0839; mKIAA0839; p150; RAB3 GTPase activating non-catalytic protein subunit 2; RAB3 GTPase activating protein subunit 2; RAB3 GTPase activating protein subunit 2 (non-catalytic); Rab3 GTPase-activating protein 150 kDa subunit; Rab3 GTPase-activating protein non-catalytic subunit; rab3-GAP p150; Rab3-GAP regulatory subunit; RAB3GAP150; RAB3-GAP150; RAB3GAP2; RGAP-iso; RGD1311518; SPG69; WARBM2
Common Name RAB3GAP2
Gene Symbol RAB3GAP2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less