missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RAB11FIP2 (aa 192-284) Control Fragment Recombinant Protein

Catalog No. RP97030
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97030 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97030 Supplier Invitrogen™ Supplier No. RP97030

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58078. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAB11FIP2 is an adapter protein that plays a role in the secretory pathway. It is thought to be important for endosome recycling and receptor-mediated endocytosis. In endosome recycling, RAB11-FIP2 regulates vesicle transport from the endosomal recycling compartment (ERC) to the plasma membrane.

Specifications

Accession Number Q7L804
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 22841
Name Human RAB11FIP2 (aa 192-284) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4930470G04Rik; A830046J09Rik; AW558126; KIAA0941; nRip11; RAB11 family interacting protein 2; RAB11 family interacting protein 2 (class I); rab11 family-interacting protein 2; rab11-family interacting protein 2; Rab11fip2; Rab11-FIP2; RAB11-FIP2 long isoform; RGD1308538
Common Name RAB11FIP2
Gene Symbol RAB11FIP2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less