Learn More
Invitrogen™ Human RAB11FIP1 (aa 423-508) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP93848
Description
Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55276 (PA5-55276. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Rab11-FIP1 (Rab 11 family-interacting protein 1), also known as Rab-coupling protein (RCP), is a 1283 amino acid Rab 11 effector protein. Rab11-FIP1, by interacting with Rab GTPases, is involved in the endosomal recycling process and may play a role in controlling membrane trafficking along the phagocytic pathway and during phagocytosis. Localized to the recycling endosome, the cytoplasmic membrane and phagosome membranes, Rab11-FIP1 is expressed as five isoforms produced by alternative splicing. As the most highly expressed isoform, isoform two of Rab11-FIP1 is expressed in brain, lung, testis, small intestine, spleen and heart. Isoform two of Rab11-FIP1 also has been found to form a homooligomer and is believed to interact with many Rab GTPases, including Rab 4A, Rab 11A, Rab 11B and Rab 25.Spécifications
Q6WKZ4 | |
Blocking Assay, Control | |
80223 | |
100 μL | |
2010200K21Rik; 4833414G05Rik; CBBM; CBP; hCG_41347; NOEL1A; Rab coupling protein; Rab effector protein; RAB11 coupling protein; RAB11 family interacting protein 1; RAB11 family interacting protein 1 (class I); rab11 family-interacting protein 1; RAB11FIP1; Rab11-FIP1; rab11fip1 {ECO:0000250; rab-coupling protein; Rab-interacting recycling protein; Rcp; RGD1562965; UniProtKB:Q6WKZ4} | |
RAB11FIP1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human RAB11FIP1 (aa 423-508) Control Fragment | |
RUO | |
RAB11FIP1 | |
Unconjugated | |
Recombinant | |
AKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |