missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99236

Invitrogen™ Human QTRT1 (aa 301-391) Control Fragment Recombinant Protein

Catalog No. RP99236
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99236 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99236 Supplier Invitrogen™ Supplier No. RP99236
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

tRNA-guanine transglycosylase (TGT; EC 2.4.2.29) synthesizes queuosine (Q), which is found in tRNAs that recognize NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kD. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60-kD subunit (USP14; MIM 607274) and a 43-kD catalytic subunit (QTRT1) (Deshpande and Katze, 2001 [PubMed 11255023]).

Specifications

Accession Number Q9BXR0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81890
Name Human QTRT1 (aa 301-391) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610028E17Rik; FP3235; Guanine insertion enzyme; QTRT1; queuine tRNA-ribosyltransferase; queuine tRNA-ribosyltransferase 1; queuine tRNA-ribosyltransferase 1 (tRNA-guanine transglycosylase); queuine tRNA-ribosyltransferase catalytic subunit 1; queuine tRNA-ribosyltransferase; queuine tRNA-ribosyltransferase catalytic subunit 1; similar to queuine tRNA-ribosyltransferase 1; Tgt; TGT, 43-KD subunit; TGT, catalytic subunit; TGUT; tRNA-guanine transglycosylase; zgc:66378
Common Name QTRT1
Gene Symbol QTRT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRDFMGAMYGDPTLCPTWA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less