missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PYCRL (aa 218-273) Control Fragment Recombinant Protein

Catalog No. RP104225
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104225 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104225 Supplier Invitrogen™ Supplier No. RP104225
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64425 (PA5-64425. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PYCRL encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precursors in the synthesis of proline. The protein encoded by this gene is a cytoplasmic enzyme involved in the biosynthesis of proline from ornithine.

Specifications

Accession Number Q53H96
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 65263
Name Human PYCRL (aa 218-273) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110058B13Rik; 2700073G24Rik; P5C reductase 3; P5CR 3; PYCR3; Pycrl; pyrroline-5-carboxylate reductase 3; pyrroline-5-carboxylate reductase-like; pyrroline-5-carboxylate reductase-like protein
Common Name PYCRL
Gene Symbol PYCR3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less