missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PUSL1 (aa 232-303) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105972
Description
Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83482 (PA5-83482. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PUSL1 is a protein coding gene. Gene ontology (GO) annotation include intracellular membrane-bounded organelle.Specifications
| Q8N0Z8 | |
| Blocking Assay, Control | |
| 126789 | |
| 100 μL | |
| pseudouridylate synthase-like 1; PUSL1; tRNA pseudouridine synthase-like 1; tRNA pseudouridylate synthase-like 1; tRNA-uridine isomerase-like 1 | |
| PUSL1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PUSL1 (aa 232-303) Control Fragment | |
| RUO | |
| PUSL1 | |
| Unconjugated | |
| Recombinant | |
| RQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFGSHG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |