missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104184

Invitrogen™ Human PTX3 (aa 322-381) Control Fragment Recombinant Protein

Catalog No. RP104184
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104184 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104184 Supplier Invitrogen™ Supplier No. RP104184

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64410 (PA5-64410. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pentraxins are a protein superfamily that is characterized by a cyclic multimeric structure. Ptx3, also known as tumor necrosis factor-stimulated gene sequence-14 (TSG14), is a secreted pattern-recognition receptor that has a non-redundant role in resistance to selected microbial agents. Ptx3 belongs to the family of 'long pentraxins', which have C-terminal pentraxin domains and novel amino-terminal domains. Ptx3 binds selected pathogens, including Aspergillus fumigatus, Pseudomonas aeruginosa and Salmonella typhimurium. It is synthesized in IgA glomerulonephritis and activates mesangial cells. Secretion of Ptx3 in adipose cells can be induced by TNF. Ptx3 is also involved in amplification of inflammatory reactions and regulation of innate immunity. The human PTX3 gene maps to chromosome 3q25.

Specifications

Accession Number P26022
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5806
Name Human PTX3 (aa 322-381) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI607804; long pentraxin 3; pentaxin related; pentaxin-related protein PT x 3; pentraxin 3; pentraxin 3, long; pentraxin related; pentraxin related gene; pentraxin-related protein PT x 3; Pt x 3; TNF alpha-induced protein 5; TNFAIP5; Tsg14; TSG-14; Tumor necrosis factor alpha-induced protein 5; tumor necrosis factor-inducible gene 14 protein; tumor necrosis factor-inducible protein TSG-14
Common Name PTX3
Gene Symbol PTX3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less