missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PTPRH (aa 615-747) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109971
Description
Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144686 (PA5-144686. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. The extracellular region contains eight fibronectin type III-like repeats and multiple N-glycosylation sites. The gene was shown to be expressed primarily in brain and liver, and at a lower level in heart and stomach. It was also found to be expressed in several cancer cell lines, but not in the corresponding normal tissues.Specifications
| Q9HD43 | |
| Blocking Assay, Control | |
| 5794 | |
| 100 μL | |
| Bem2; brain-enriched membrane-associated protein tyrosine BEM-2; protein tyrosine phosphatase, receptor type H; protein tyrosine phosphatase, receptor type, H; PTPRH; receptor-type tyrosine-protein phosphatase H; R-PTP-H; SAP1; SAP-1; Stomach cancer-associated protein tyrosine phosphatase 1; transmembrane-type protein-tyrosine phosphatase type H | |
| PTPRH | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PTPRH (aa 615-747) Control Fragment | |
| RUO | |
| PTPRH | |
| Unconjugated | |
| Recombinant | |
| QANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLCASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLGLGPARSYPATITTIWDGMKVVSHSVVC | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |