missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108398

Invitrogen™ Human PTPN18 (aa 384-448) Control Fragment Recombinant Protein

Catalog No. RP108398
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108398 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108398 Supplier Invitrogen™ Supplier No. RP108398

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84151 (PA5-84151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Differentially dephosphorylate autophosphorylated tyrosine kinases which are known to be overexpressed in tumor tissues.

Specifications

Accession Number Q99952
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26469
Name Human PTPN18 (aa 384-448) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BDP1; Brain-derived phosphatase; fetal liver phosphatase 1; FLP1; FLP-1; HSCF; protein tyrosine phosphatase 20; protein tyrosine phosphatase, non-receptor type 18; protein tyrosine phosphatase, non-receptor type 18 (brain-derived); PTP20; PTP-HSCF; Ptpk1; PTP-K1; Ptpn18; Tyrosine-protein phosphatase non-receptor type 18
Common Name PTPN18
Gene Symbol PTPN18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less