missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PTGER3 (aa 1-51) Control Fragment Recombinant Protein

Catalog No. RP90626
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90626 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90626 Supplier Invitrogen™ Supplier No. RP90626

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD172a, also known as signal-regulatory protein alpha, is a receptor-type transmembrane glycoprotein expressed on cells of myeloid origin, including granulocytes, dendritic cells (DCs), macrophages, mast cells and haematopoietic stem cells. CD172a acts as a substrate for several activated tyrosine kinases, including EGFR, PDGFR, src and insulin receptor and is involved in the negative regulation of receptor tyrosine kinase-coupled signaling pathways. Ligand binding of CD172a to integrin-associated protein CD47, results in tyrosine kinase phosphorylation of immunoreceptor tyrosine-based inhibitory motifs (ITIMs) within the cytoplasmic region of CD172a, mediating the recruitment and activation of the tyrosine phosphatases SHP-1 and SHP-2. These then act as regulators of cellular function, through dephosphorylation of specific substrates. Ligation of CD172a with CD47 has been demonstrated in several regulatory processes, including the inhibition of host cell phagocytosis by macrophages and the bi-directional activation of T cells and DCs.

Specifications

Accession Number P43115
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5733
Name Human PTGER3 (aa 1-51) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EP3; Ep3 receptor; EP3A receptor; EP3B receptor; EP3C receptor; EP3D receptor; EP3e; EP3-I; EP3-II; EP3-III; EP3-IV; EP3-VI; MGC141828; MGC141829; MGC27302; PGE receptor EP3 subtype; PGE receptor, EP3 subtype; PGE2 receptor EP3 subtype; PGE2-R; Pgerep3; pr; prostaglandin E receotor EP3 subtype 3 isoform; prostaglandin E receptor 3; prostaglandin E receptor 3 (subtype EP3); prostaglandin E receptor EP3 subtype; prostaglandin E2 receptor EP3 subtype; prostaglandin receptor (PGE-2); prostanoid EP3 receptor; PTGER3; Ptgerep3; Rep3; rEP3a; rEP3b
Common Name PTGER3
Gene Symbol PTGER3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less