missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96409

Invitrogen™ Human PSMD6 (aa 309-381) Control Fragment Recombinant Protein

Catalog No. RP96409
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96409 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96409 Supplier Invitrogen™ Supplier No. RP96409

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57870. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants.

Specifications

Accession Number Q15008
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 9861
Name Human PSMD6 (aa 309-381) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2400006A19Rik; 26S proteasome non-ATPase regulatory subunit 6; 26S proteasome non-ATPase regulatory subunit 6-like protein; 26S proteasome non-ATPase regulatory subunit-like protein; 26S proteasome regulatory subunit RPN7; 26S proteasome regulatory subunit S10; breast cancer-associated protein SGA-113M; KIAA0107; p42A; P44s10; PFAAP4; Phosphonoformate immuno-associated protein 4; proteasome (prosome, macropain) 26S subunit, non-ATPase, 6; proteasome 26S subunit, non-ATPase 6; proteasome regulatory particle subunit p44S10; proteasome, 26S, non-ATPase regulatory subunit 6; PSMD6; Rpn7; S10; SGA-113M; vov; zgc:56471
Common Name PSMD6
Gene Symbol PSMD6
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less