missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98827

Invitrogen™ Human PSMD4 (aa 36-90) Control Fragment Recombinant Protein

Catalog No. RP98827
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98827 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98827 Supplier Invitrogen™ Supplier No. RP98827

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit functions as guanine nucleotide exchange factor. It is reported that this subunit interacts with HIV-1 Tat, and thus it represses the translation of host-cell, but not HIV-1, mRNAs. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.

Specifications

Accession Number P55036
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5710
Name Human PSMD4 (aa 36-90) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 26 S proteasome non-ATPase regulatory subunit 4; 26 S proteasome regulatory subunit RPN10; 26 S proteasome regulatory subunit S5A; AF; Af1; AF-1; angiocidin; anti secretory factor 1; antisecretory factor; antisecretory factor 1; ASF; Mcb1; multiubiquitin chain-binding protein; multiubiquitin-chain-binding protein; proteasome (prosome, macropain) 26 S subunit, non-ATPase, 4; proteasome 26 S subunit, non-ATPase 4; Psmd4; pUB-R5; RP11-126K1.1; Rpn10; RPN10 homolog; S5A; S5a/antisecretory factor protein
Common Name PSMD4
Gene Symbol Psmd4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less