missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108732

Invitrogen™ Human PSMC1 Control Fragment Recombinant Protein

Catalog No. RP108732
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108732 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108732 Supplier Invitrogen™ Supplier No. RP108732

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.

Specifications

Accession Number P62191
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5700
Name Human PSMC1 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 26 S protease regulatory subunit 4; 26 S proteasome AAA-ATPase subunit RPT2; 26 S proteasome regulatory subunit 4; AI325227; MGC24583; MGC8541; P26s4; p56; peptidase (prosome, macropain) 26 S subunit, ATPase 1; protease (prosome, macropain) 26 S subunit, ATPase 1; proteasome (prosome, macropain) 26 S subunit, ATPase, 1; proteasome 26 S ATPase subunit 1; proteasome 26 S subunit ATPase 1; proteasome 26 S subunit, ATPase 1; proteasome 26 S subunit, ATPase, 1; prs4; Psmc1; rpt2; Rpt2/S4; S4
Common Name PSMC1
Gene Symbol Psmc1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGGGTSGSGSSSGQGKMGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less