missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PSD-95 (aa 405-535) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP89569
Description
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Post Synaptic Density 95 kDa (PSD-95), also known as synapse associated protein 90 kDa (SAP90), is one of a family of membrane-associated proteins found in the postsynaptic density in forebrain neurons and certain presynaptic structures in the cerebellum. Like other members of the family, PSD-95 has three 90 amino acid repeats called PDZ domains followed by an SH3 domain and a yeast guanylate kinase homology (GuK) domain. PSD-95 is believed to participate in the clustering of certain proteins, including NMDA receptors, Shaker-type potassium channels at the synaptic membrane in central nervous system (CNS) neurons. There are two principal modes of interaction between PSD-95 and other proteins. NMDA receptors and shaker-type potassium channels both share C-terminal sequence homology consisting of a threonine/serine-X-valine-COOH (T/SXV) motif. Other neuronal proteins that share this motif (beta 1 adrenergic receptor, some serotonin receptors, some sodium channel subunits, and additional potassium channel subunits), and some of these proteins may interact with PSD-95 by binding to its PDZ domains. Neuronal nitric oxide synthase (nNOS), which lacks the T/SXV motif but which has its own PDZ domain, has been shown to associate with PSD-95 in vitro through a pseudo-homotypic PDZ-PDZ interaction.Specifications
| P78352 | |
| Blocking Assay, Control | |
| 1742 | |
| 100 μL | |
| discs large homolog 4; discs large MAGUK scaffold protein 4; discs, large homolog 4; discs, large homolog 4 (Drosophila); disks large homolog 4; Dlg4; Dlgh4; FLJ97752; FLJ98574; post synaptic density; postsynaptic density protein 95; post-synaptic density protein 95; PSD95; PSD-95; PSD-95 alpha 2 b; PSD-95 beta; Sap90; SAP-90; SAP90A; Synapse-associated protein 90; synapse-associated protein SAP90; Tax interaction protein 15 | |
| DLG4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PSD-95 (aa 405-535) Control Fragment | |
| RUO | |
| PSD-95 | |
| Unconjugated | |
| Recombinant | |
| HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |