missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94125

Invitrogen™ Human PRRC2C Control Fragment Recombinant Protein

Catalog No. RP94125
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94125 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94125 Supplier Invitrogen™ Supplier No. RP94125

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55257. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proline-rich coiled-coil 2C (PRRC2C) is proposed to be involved in protein C-terminus binding and contains a conserved BAT2 N-terminus domain.

Specifications

Accession Number Q9Y520
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 23215
Name Human PRRC2C Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias BAT2 domain containing 1; BAT2 domain-containing protein 1; BAT2D1; BAT2-iso; BAT2L2; HBV XAg-transactivated protein 2; HBV X-transactivated gene 2 protein; HBxAg transactivated protein 2; HLA-B associated transcript 2-like 2; HLA-B-associated transcript 2-like 2; KIAA1096; proline rich coiled-coil 2C; proline-rich and coiled-coil-containing protein 2C; proline-rich coiled-coil 2C; protein BAT2-like 2; protein PRRC2C; PRRC2C; XTP2
Common Name PRRC2C
Gene Symbol PRRC2C
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DVRPHHTDANNQSACFEAPDQKTLSTPQEERISAVESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVTSRCIDSKEP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less