missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Protein S (aa 280-425) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100452
Description
Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110896 (PA5-110896. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Protein S is a vitamin K-dependent, potent neutral anticoagulant plasma glycoprotein. Protein S has a molecular weight of approximately 70 kDa and consists of a single polypeptide chain. The concentration of protein S in human plasma is 25 μg/mL, with a half-life of approximately two days. About 40% of Protein S in plasma is in a free form, whereas 60% is complexed with C4b-binding Protein (C4BP). Only the free Protein S functions as a cofactor to antigen presenting cells (APC) in the APC-dependent degradation of Factor Va and Factor VIIIa.Specifications
| P07225 | |
| Blocking Assay, Control | |
| 5627 | |
| 100 μL | |
| AW214361; Preproprotein S; PROS; PROS 1; PROS1; protein S; protein S (alpha); Protein S alpha; protein Sa; proteinS; PS 21; PS 22; PS 23; PS 24; PS 25; PS 26; PS21; PS22; PS23; PS24; PS25; PS26; PSA; rabbit protein S; THPH5; THPH6; unnamed protein product; vitamin K-dependent plasma protein S; vitamin K-dependent protein S; vitamin K-dependent protein S precursor | |
| PROS1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Protein S (aa 280-425) Control Fragment | |
| RUO | |
| Protein S | |
| Unconjugated | |
| Recombinant | |
| KSCEVVSVCLPLNLDTKYELLYLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGLLETKV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |