missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Protein APC (aa 1016-1140) Control Fragment Recombinant Protein

Catalog No. RP101882
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101882 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101882 Supplier Invitrogen™ Supplier No. RP101882
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a tumor suppressor protein that acts as an antagonist of the Wnt signaling pathway. It is also involved in other processes including cell migration and adhesion, transcriptional activation, and apoptosis. Defects in this gene cause familial adenomatous polyposis (FAP), an autosomal dominant pre-malignant disease that usually progresses to malignancy. Disease-associated mutations tend to be clustered in a small region designated the mutation cluster region (MCR) and result in a truncated protein product.

Specifications

Accession Number P25054
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 324
Name Human Protein APC (aa 1016-1140) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias adenomatosis polyposis coli; adenomatosis polyposis coli tumor suppressor; adenomatous polyposis coli; adenomatous polyposis coli protein; AI047805; APC; APC, WNT signaling pathway regulator; AU020952; AW124434; BTPS2; CC1; Deleted in polyposis 2.5; DP2; DP2.5; DP3; FAP; FPC; GS; mAPC; Min; multiple intestinal neoplasia; PPP1R46; Protein APC; protein phosphatase 1, regulatory subunit 46; RATAPC; truncated adenomatosis polyposis coli; WNT signaling pathway regulator
Common Name Protein APC
Gene Symbol Apc
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less