missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PROSC (aa 190-258) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP93805
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54875 (PA5-54875. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Pyridoxal 5'-phosphate (PLP)-binding protein, which may be involved in intracellular homeostatic regulation of pyridoxal 5'-phosphate (PLP), the active form of vitamin B6.Specifications
| O94903 | |
| Blocking Assay, Control | |
| 11212 | |
| 100 μL | |
| 1700024N20Rik; 2200002F22Rik; PLP homeostasis protein; PLPBP; Proline synthase co-transcribed bacterial homolog protein; proline synthetase co-transcribed; proline synthetase co-transcribed (bacterial homolog); proline synthetase co-transcribed bacterial homolog protein; proline synthetase co-transcribed homolog; proline synthetase cotranscribed homolog (bacterial); PROSC; Pyridoxal phosphate homeostasis protein; Pyridoxal phosphate-binding protein | |
| PLPBP | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PROSC (aa 190-258) Control Fragment | |
| RUO | |
| PROSC | |
| Unconjugated | |
| Recombinant | |
| LSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |