missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108174

Invitrogen™ Human Profilin 1 Control Fragment Recombinant Protein

Catalog No. RP108174
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108174 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108174 Supplier Invitrogen™ Supplier No. RP108174

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Profilin is an ubiquitous small (12-15 kDa) phosphoinositides and poly-L-proline binding protein that plays a role in both signal transduction pathways and actin filament dynamics. There are two mammalian profilins with similar biochemical properties but different expression patterns. Profilin I appears to be highly expressed in most tissues except for skeletal muscle. Profilin II is predominantly expressed in brain and at lower levels in skeletal muscle, uterus and kidney. Profilin is a mainly cytosolic protein with higher concentrations in dynamic membrane areas like the leading edge and ruffling membranes.

Specifications

Accession Number P07737
Concentration 3.70 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 5216
Name Human Profilin 1 Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias actin binding protein; ALS18; Epididymis tissue protein Li 184a; Pfn; Pfn1; profilin 1; profilin I; Profilin-1
Common Name Profilin 1
Gene Symbol Pfn1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSIGGAPTFNVTVTKTDKTLVLLMGKEGIHG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less