missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107361

Invitrogen™ Human PRMT5 (aa 75-171) Control Fragment Recombinant Protein

Catalog No. RP107361
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107361 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107361 Supplier Invitrogen™ Supplier No. RP107361

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRMT5 (protein arginine N-methyltransferase 5) is an arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. PRMT5 specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3; such methylation is required for the assembly and biogenesis of snRNP core particles.

Specifications

Accession Number O14744
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10419
Name Human PRMT5 (aa 75-171) Control Fragment
Quantity 100 μL
Gene Alias 72 kDa ICln-binding protein; EC 2.1.1.125; histone-arginine N-methyltransferase PRMT5; HMT1 hnRNP methyltransferase-like 5; HRMT1L5; hypothetical protein; I79_013398; IBP72; Jak-binding protein 1; JBP1; PRMT5; protein arginine methyltransferase 5; protein arginine N-methyltransferase 5; Protein arginine N-methyltransferase 5, N-terminally processed; protein arginine N-methyltransferase 5-like; shk1 kinase-binding protein 1 homolog; Skb1; SKB1 homolog; SKB1Hs
Common Name PRMT5
Gene Symbol PRMT5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less