missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PRKAR1A (aa 47-87) Control Fragment Recombinant Protein

Catalog No. RP101188
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101188 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101188 Supplier Invitrogen™ Supplier No. RP101188
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62112 (PA5-62112. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Three alternatively spliced transcript variants encoding the same protein have been observed.

Specifications

Accession Number P10644
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5573
Name Human PRKAR1A (aa 47-87) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1300018C22Rik; ACRDYS1; ADOHR; cAMP-dependent protein kinase regulatory subunit RIalpha; cAMP-dependent protein kinase type I-alpha regulatory chain; cAMP-dependent protein kinase type I-alpha regulatory subunit; cAMP-dependent protein kinase type I-alpha regulatory subunit, N-terminally processed; CAR; Carney complex type 1; CNC; CNC1; PKR1; PPNAD1; PRKAR1; Prkar1a; protein kinase A type 1 A regulatory subunit; protein kinase cAMP-dependent type I regulatory subunit alpha; protein kinase, cAMP dependent regulatory, type 1, alpha; protein kinase, cAMP dependent regulatory, type I, alpha; protein kinase, cAMP-dependent, regulatory subunit type I alpha; protein kinase, cAMP-dependent, regulatory, type I, alpha; RIalpha; RIIA; Tissue-specific extinguisher 1; Tse1; Tse-1
Common Name PRKAR1A
Gene Symbol PRKAR1A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less