missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93342

Invitrogen™ Human PRAC (aa 1-57) Control Fragment Recombinant Protein

Catalog No. RP93342
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93342 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93342 Supplier Invitrogen™ Supplier No. RP93342
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61612. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRAC is a novel gene that is expressed in human prostate, prostate cancer, rectum and distal colon. The nuclear localization, identification of potential phosphorylation sites, and possible cotranscription with the Hoxb-13 gene suggest that PRAC may have a regulatory role in the nucleus.

Specifications

Accession Number Q96KF2
Concentration 3.6 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 84366
Name Human PRAC (aa 1-57) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias C17orf92; MGC32520; PRAC; PRAC1; prostate cancer susceptibility candidate 1; prostate cancer susceptibility candidate protein 1; Prostate, rectum and colon expressed gene protein; small nuclear protein PRAC; small nuclear protein PRAC1
Common Name PRAC
Gene Symbol PRAC1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less