missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99100

Invitrogen™ Human PPAN (aa 421-460) Control Fragment Recombinant Protein

Catalog No. RP99100
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99100 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99100 Supplier Invitrogen™ Supplier No. RP99100
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60302 (PA5-60302. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is an evolutionarily conserved protein similar to yeast SSF1 as well as to the gene product of the Drosophila gene peter pan (ppan). SSF1 is known to be involved in the second step of mRNA splicing. Both SSF1 and ppan are essential for cell growth and proliferation. Exogenous expression of this gene was reported to reduce the anchorage-independent growth of some tumor cells. Read-through transcription of this gene with P2RY11/P2Y(11), an adjacent downstream gene that encodes an ATP receptor, has been found. These read-through transcripts are ubiquitously present and up-regulated during granulocyte differentiation.

Specifications

Accession Number Q9NQ55
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56342
Name Human PPAN (aa 421-460) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A230087P06Rik; Brix domain-containing protein 3; BXDC3; homolog of S. cerevisiae SSF1; Peter Pan homolog; peter pan homolog (Drosophila); Ppan; second-step splicing factor 1; SSF; Ssf1; ssf-1; SSF2; suppressor of sterile four 1; suppressor of SWI4 1 homolog
Common Name PPAN
Gene Symbol PPAN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less