missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human POLE (aa 303-387) Control Fragment Recombinant Protein

Catalog No. RP107568
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107568 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107568 Supplier Invitrogen™ Supplier No. RP107568

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84756 (PA5-84756. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

POLE (Polepsi) is present in proliferating cells and is implicated in repair of UV-damaged DNA.

Specifications

Accession Number Q07864
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5426
Name Human POLE (aa 303-387) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CRCS12; DNA polymerase epsilon catalytic subunit A; DNA polymerase epsilon catalytic subunit protein; DNA polymerase epsilon, catalytic subunit; DNA polymerase II subunit A; DNA-directed DNA polymerase epsilon; FILS; Pole; POLE1; pol-epsilon; polymerase (DNA directed), epsilon; polymerase (DNA directed), epsilon, catalytic subunit; polymerase (DNA) epsilon, catalytic subunit
Common Name POLE
Gene Symbol POLE
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEAHLIQRWFEHVQETKPTIMVTYNGDFFDWPFVEARAAVHGLSMQQEI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less