missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PLCB3 (aa 462-555) Control Fragment Recombinant Protein

Catalog No. RP97385
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97385 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97385 Supplier Invitrogen™ Supplier No. RP97385

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83691. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLCB3 encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1,4,5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants.

Specifications

Accession Number Q01970
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 5331
Name Human PLCB3 (aa 462-555) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3; EC 3.1.4.11; mKIAA4098; Phosphoinositide phospholipase C-beta-3; phosphoinositide-specific phospholipase c; phospholipase C beta 3; phospholipase C, beta 3; phospholipase C, beta 3 (phosphatidylinositol-specific); phospholipase C-beta-3; PLC beta 3; Plcb3; PLCbeta3; PLC-beta3; PLC-beta-3
Common Name PLCB3
Gene Symbol Plcb3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RILVKNKKRHRPSAGGPDSAGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGDEGLNRGPYVLGPADR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less