missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Plasminogen (aa 251-312) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92037
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Plasminogen is a plasma protein synthesized mostly in the liver. It consists of a single polypeptide chain and has a molecular weight of 88.5 kDa. The plasma concentration is usually in the range of 70 - 200 mg/L. Plasminogen is activated by tissue-plasminogen activator, urokinase and streptokinase, to form plasmin. Activation results from the cleavage and release of the preactivation peptide. Plasmin consists of a heavy (A-) chain which contains 5 kringles and a light (B-) chain with the active site. Plasmin is a trypsin-like protease whose natural substrate is fibrin, with binding sites for fibrin residing on the kringles. Plasmin is essential for fibrinolysis and decreased fibrinolytic potential due to congenital defects in plasmin can lead to recurring thrombosis, thrombophlebitis and pulmonary embolism.Specifications
| P00747 | |
| Blocking Assay, Control | |
| 5340 | |
| 100 μL | |
| Ab1-346; Activation peptide; AI649309; angiostatin; DKFZp779M0222; Pg; plasmin; plasmin heavy chain A; Plasmin heavy chain A, short form; Plasmin light chain B; plasminogen; PLG; RP1-81D8.1 | |
| PLG | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Plasminogen (aa 251-312) Control Fragment | |
| RUO | |
| Plasminogen | |
| Unconjugated | |
| Recombinant | |
| NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |