missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95008

Invitrogen™ Human PKC mu (aa 849-908) Control Fragment Recombinant Protein

Catalog No. RP95008
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95008 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95008 Supplier Invitrogen™ Supplier No. RP95008
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83107 (PA5-83107. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PKC family of serine/threonine kinases, including PRKCN (PKD3), is activated intracellularly by signal transduction pathways. In humans, at least 12 different PKC polypeptides have been identified. These isoforms differ in primary structure, tissue distribution, subcellular localization, mode of action in vitro, response to extracellular signals, and substrate specificity. PKC alpha, beta I, beta II and gamma form the conventional family; their activities are Ca2+- and phospholipid-dependent. PKC mu activation is dependent on the phosphorylation of two activation loop sites, Ser744 and Ser748, via a PKC-dependent signaling pathway.

Specifications

Accession Number O94806, Q15139, Q9BZL6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23683, 25865, 5587
Name Human PKC mu (aa 849-908) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930557O20Rik; 5730497N19Rik; AI325941; DKFZP586E0820; EPK2; HSPC187; nPKC-D1; nPKC-D2; nPKC-mu; nPKC-nu; PKC mu; PKC nu; PKC u; PKC v; Pkcm; PKCmu; PKC-MU; Pkcnu; PKC-NU; PKCu; PKC-u; PKCv; PKC-v; Pkd; PKD1; PKD2; PKD3; Prkcm; PRKCN; Prkd1; PRKD2; PRKD3; Protein kinase C mu type; protein kinase C nu type; protein kinase C, mu; protein kinase C, nu; protein kinase D; protein kinase D1; protein kinase D2; protein kinase D3; protein kinase EPK2; RGD1308054; Serine/threonine-protein kinase D1; serine/threonine-protein kinase D2; Serine/threonine-protein kinase D3
Common Name PKC mu
Gene Symbol PRKD1, Prkd2, Prkd3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEETEMKALGER
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less