missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PIDD (aa 811-890) Control Fragment Recombinant Protein

Catalog No. RP109118
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109118 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109118 Supplier Invitrogen™ Supplier No. RP109118

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain.

Specifications

Accession Number Q9HB75
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55367
Name Human PIDD (aa 811-890) Control Fragment
Quantity 100 μL
Gene Alias 1200011D09Rik; AU042446; DKFZp434D229; leucine-rich and death domain containing; leucine-rich repeat and death domain-containing protein; leucine-rich repeats and death domain containing; Lrdd; MGC16925; p53 induced death domain protein 1; p53 protein induced, with death domain; p53-induced death domain protein 1; p53-induced death domain-containing protein 1; p53-induced protein with a death domain; Pidd; Pidd1; PIDD-C; PIDD-CC; PIDD-N
Common Name PIDD
Gene Symbol PIDD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less