missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94029

Invitrogen™ Human PGM1 (aa 482-559) Control Fragment Recombinant Protein

Catalog No. RP94029
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94029 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94029 Supplier Invitrogen™ Supplier No. RP94029

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55008 (PA5-55008. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphoglucomutases (PGM; EC 5.4.2.2) catalyze the transfer of phosphate between the 1 and 6 positions of glucose. Isozymes of PGM are monomeric, with molecular masses of about 60 kD, and are encoded by several genes, including PGM1. In most cell types, PGM1 isozymes predominate, representing about 90% of total PGM activity. One exception is red cells, where PGM2 (MIM 172000) is a major isozyme (Putt et al., 1993 [PubMed 8257433]). [supplied by OMIM].

Specifications

Accession Number P36871
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5236
Name Human PGM1 (aa 482-559) Control Fragment
Quantity 100 μL
Gene Alias 3230402E02Rik; Aciculin; CDG1T; Glucose phosphomutase 1; glucose phosphomutase 2; GSD14; PGM; PGM 1; PGM 2; Pgm1; Pgm-1; Pgm2; PGM5; PGMRP; PGM-RP; Phosphodeoxyribomutase; phosphoglucomutase 1; phosphoglucomutase 2; phosphoglucomutase 5; phosphoglucomutase isoform 2; phosphoglucomutase isoform1; phosphoglucomutase-1; Phosphoglucomutase-2; phosphoglucomutase-like protein 5; Phosphoglucomutase-related protein; phosphopentomutase; zgc:63718
Common Name PGM1
Gene Symbol PGM1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less