missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103675

Invitrogen™ Human PGAP1 (aa 765-818) Control Fragment Recombinant Protein

Catalog No. RP103675
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103675 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103675 Supplier Invitrogen™ Supplier No. RP103675

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64424 (PA5-64424. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in inositol deacylation of GPI-anchored proteins. GPI inositol deacylation may important for efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi.

Specifications

Accession Number Q75T13
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80055
Name Human PGAP1 (aa 765-818) Control Fragment
Quantity 100 μL
Gene Alias 5033403E17Rik; 9030223K07Rik; A530084K22; Bst1; D230012E17Rik; GPI deacylase; GPI inositol-deacylase; hPGAP1; ISPD3024; MRT42; oto; PGAP1; Post GPI Attachment to Proteins 1; post-GPI attachment to proteins 1; post-GPI attachment to proteins factor 1; SPG67; UNQ3024/PRO9822
Common Name PGAP1
Gene Symbol Pgap1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less