missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PFKFB3 (aa 93-229) Control Fragment Recombinant Protein

Catalog No. RP89865
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89865 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89865 Supplier Invitrogen™ Supplier No. RP89865

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110743. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate (F2,6BP), and a fructose-2,6-biphosphatase activity that catalyzes the degradation of F2,6BP. This protein is required for cell cycle progression and prevention of apoptosis. It functions as a regulator of cyclin-dependent kinase 1, linking glucose metabolism to cell proliferation and survival in tumor cells. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number Q16875
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 5209
Name Human PFKFB3 (aa 93-229) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 6-biphosphatase 3; 6PF-2-K/Fru-2,6-P2ase 3; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; 6PF-2-K/Fru-2,6-P2ASE brain-type isozyme; 6-phosphofructo-2-kinase; 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3; E330010H22Rik; Fructose-2; Fructose-2,6-bisphosphatase; fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase; inducible 6-phosphofructo-2-kinase; inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; IPFK2; iPFK-2; PFK/FBPase 3; PFK2; PFKFB3; RB2K; renal carcinoma antigen NY-REN-56; RP11-298K24.3; uPFK-2
Common Name PFKFB3
Gene Symbol PFKFB3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less