missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PES1 (aa 238-316) Control Fragment Recombinant Protein

Catalog No. RP105400
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105400 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105400 Supplier Invitrogen™ Supplier No. RP105400
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84733 (PA5-84733. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphomannose isomerase catalyzes the interconversion of fructose-6-phosphate and mannose-6-phosphate and plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions. Mutations in the MPI gene were found in patients with carbohydrate-deficient glycoprotein syndrome, type Ib.

Specifications

Accession Number O00541
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23481
Name Human PES1 (aa 238-316) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias HAMAP-Rule:MF_03028}; Pes; PES1; Pescadillo homolog; pescadillo homolog {ECO:0000255; pescadillo homolog 1, containing BRCT domain; pescadillo homolog 1, containing BRCT domain (zebrafish); pescadillo ribosomal biogenesis factor 1
Common Name PES1
Gene Symbol Pes1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less