missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Perlecan (aa 485-577) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109301
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140142 (PA5-140142. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Perlecan is a major heparan-sulfate proteoglycan (HSPG) found within all basement membranes and cell surfaces. Because of its strategic location and ability to store and protect growth factors, perlecan has been strongly implicated in the control of tumor cell growth and metastatic behavior. Perlecan possesses angiogenic and growth-promoting attributes primarily by acting as a coreceptor for basic fibroblast growth factor (FGF-2). Suppression of perlecan causes substantial inhibition of neoplastic growth and neovascularization. Thus, perlecan is a potent inducer of neoplasm growth and angiogenesis in vivo and therapeutic interventions targeting this key modulator of tumor progression may improve neoplastic treatment.Specifications
| P98160 | |
| Blocking Assay, Control | |
| 3339 | |
| 100 μL | |
| AI852380; Basement membrane-specific heparan sulfate proteoglycan core protein; Endorepellin; endorepellin (domain V region); heparan sulfate proteoglycan 2; HSPG; Hspg2; LG3 peptide; LOC313641; Pcn; per; perlecan; perlecan (heparan sulfate proteoglycan 2); perlecan proteoglycan; PLC; PRCAN; RP11-132G19.2; SJA; SJS; SJS1 | |
| HSPG2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Perlecan (aa 485-577) Control Fragment | |
| RUO | |
| Perlecan | |
| Unconjugated | |
| Recombinant | |
| RGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |