missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97917

Invitrogen™ Human PDS5B (aa 1245-1328) Control Fragment Recombinant Protein

Catalog No. RP97917
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97917 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97917 Supplier Invitrogen™ Supplier No. RP97917
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59029 (PA5-59029. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that interacts with the conserved protein complex termed cohesin. The cohesin complex holds together sister chromatids and facilitates accurate chromosome segregation during mitosis and meiosis. This protein is also a negative regulator of cell proliferation and may be a tumor-suppressor gene.

Specifications

Accession Number Q9NTI5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23047
Name Human PDS5B (aa 1245-1328) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI646570; androgen induced inhibitor of proliferation; androgen-induced proliferation inhibitor; androgen-induced prostate proliferative shutoff associated protein; androgen-induced prostate proliferative shutoff associated protein AS3; androgen-induced prostate proliferative shutoff-associated protein AS3; androgen-induced shutoff 3; Aprin; As3; AW212954; CG008; Kiaa0979; mKIAA0979; PDS5 cohesin associated factor B; PDS5, regulator of cohesion maintenance, homolog B; PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae); Pds5b; Sister chromatid cohesion protein PDS5 homolog B
Common Name PDS5B
Gene Symbol PDS5B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less