missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PDCL3 (aa 179-239) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92035
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53810 (PA5-53810. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Phosducin-like proteins (PhLPs) are a conserved family of proteins with thioredoxin-like domains that were initially identified as modulators of G protein signaling. PDCL3 is highly homologous to PDCL and shares an N-terminal helix domain and a C-terminal thioredoxin-fold (Trx-fold) domain. Along with the related protein PDCL2, PDCL3 interacts with the chaperonin CCT and modulates CCT-mediated actin and tubulin folding. Modulation of PDCL3 levels by MAPK phosphorylation and RhoA-dependent changes also promote cytoskeletal remodeling.Specifications
| Q9H2J4 | |
| Blocking Assay, Control | |
| 79031 | |
| 100 μL | |
| 1110061A19Rik; C80025; HTPHLP; IAP-associated factor VIAF1; PDCL3; PhLP2A; PHLP3; phosducin like 3; phosducin-like 3; phosducin-like protein 3; PhPL3; VIAF; VIAF1; VIAF-1; Viral IAP-associated factor 1 | |
| PDCL3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PDCL3 (aa 179-239) Control Fragment | |
| RUO | |
| PDCL3 | |
| Unconjugated | |
| Recombinant | |
| IGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |