missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PDCD10 (aa 1-65) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92030
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55503 (PA5-55503. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified.Specifications
| Q9BUL8 | |
| Blocking Assay, Control | |
| 11235 | |
| 100 μL | |
| 2410003B13Rik; apoptosis-related protein 15; CCM3; Cerebral cavernous malformations 3 protein; MGC1212; MGC24477; PDCD 10; PDCD10; programmed cell death 10; programmed cell death protein 10; TF-1 cell apoptosis-related protein 15; Tfa15; TFAR15 | |
| Pdcd10 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PDCD10 (aa 1-65) Control Fragment | |
| RUO | |
| PDCD10 | |
| Unconjugated | |
| Recombinant | |
| MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |