missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PCOLCE (aa 298-373) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104765
Description
Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83637 (PA5-83637. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.Specifications
| Q15113 | |
| Blocking Assay, Control | |
| 5118 | |
| 100 μL | |
| astroglial cell transcript 2; Astt2; Astt-2; P14; Pcolce; PCPE; PCPE1; PCPE-1; procollagen C-endopeptidase enhancer; procollagen C-endopeptidase enhancer 1; procollagen C-endopeptidase enhancer protein; procollagen COOH-terminal proteinase enhancer 1; procollagen C-proteinase enhancer 1; procollagen C-proteinase enhancer protein; procollagen, type 1, COOH-terminal proteinase enhancer; type 1 procollagen C-proteinase enhancer protein; Type I procollagen COOH-terminal proteinase enhancer | |
| PCOLCE | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PCOLCE (aa 298-373) Control Fragment | |
| RUO | |
| PCOLCE | |
| Unconjugated | |
| Recombinant | |
| PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |