missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96848

Invitrogen™ Human PCBD2 (aa 27-79) Control Fragment Recombinant Protein

Catalog No. RP96848
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96848 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96848 Supplier Invitrogen™ Supplier No. RP96848
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57654 (PA5-57654. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PCBD2 (Pterin-4-alpha-carbinolamine dehydratase 2) is also named DCOH2, DCOHM and belongs to the pterin-4-alpha-carbinolamine dehydratase family. It is involved in tetrahydrobiopterin biosynthesis and it seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. PCBD2 also regulates the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity.

Specifications

Accession Number Q9H0N5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84105
Name Human PCBD2 (aa 27-79) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700061N24Rik; 4-alpha-hydroxy-tetrahydropterin dehydratase 2; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; DCOH2; dcoH-like protein DCoHm; Dcohm; dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle; dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); dimerization cofactor of hepatocyte nuclear factor 1 alpha 2; dimerization cofactor of hepatocyte nuclear factor 1 from muscle; HNF-1-alpha dimerization cofactor; PCBD2; PHS 2; PHS2; pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; pterin-4 alpha-carbinolamine dehydratase 2; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; pterin-4-alpha-carbinolamine dehydratase 2
Common Name PCBD2
Gene Symbol Pcbd2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less