missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PCBD2 (aa 27-79) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP96848
Description
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57654 (PA5-57654. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PCBD2 (Pterin-4-alpha-carbinolamine dehydratase 2) is also named DCOH2, DCOHM and belongs to the pterin-4-alpha-carbinolamine dehydratase family. It is involved in tetrahydrobiopterin biosynthesis and it seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. PCBD2 also regulates the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity.Specifications
| Q9H0N5 | |
| Blocking Assay, Control | |
| 84105 | |
| 100 μL | |
| 2700061N24Rik; 4-alpha-hydroxy-tetrahydropterin dehydratase 2; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; DCOH2; dcoH-like protein DCoHm; Dcohm; dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle; dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); dimerization cofactor of hepatocyte nuclear factor 1 alpha 2; dimerization cofactor of hepatocyte nuclear factor 1 from muscle; HNF-1-alpha dimerization cofactor; PCBD2; PHS 2; PHS2; pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; pterin-4 alpha-carbinolamine dehydratase 2; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; pterin-4-alpha-carbinolamine dehydratase 2 | |
| Pcbd2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PCBD2 (aa 27-79) Control Fragment | |
| RUO | |
| PCBD2 | |
| Unconjugated | |
| Recombinant | |
| AMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |