missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90816

Invitrogen™ Human PBRM1 (aa 102-247) Control Fragment Recombinant Protein

Catalog No. RP90816
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90816 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90816 Supplier Invitrogen™ Supplier No. RP90816

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82531. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PBRM1 gene encodes a subunit of the PBAF (Polybromo-associated BAF) chromatin remodeling complex, playing a crucial role in the regulation of chromatin structure and transcription. PBRM1, also known as BAF180, contains bromodomains that recognize acetylated lysine residues on histone tails, facilitating chromatin remodeling necessary for effective transcriptional regulation. This gene is frequently mutated in renal cell carcinoma, particularly clear cell renal cell carcinoma (ccRCC), where such mutations are implicated in the pathogenesis of the disease. PBRM1 acts as a tumor suppressor, and its loss of function can lead to deregulation of gene expression, contributing to oncogenic processes. It is involved in pathways that govern cell cycle regulation and DNA damage response, reflecting its importance in maintaining genomic stability. Ongoing research focuses on understanding PBRM1's interactions within chromatin remodeling complexes and its potential as a therapeutic target in cancer treatment.

Specifications

Accession Number Q86U86
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 55193
Name Human PBRM1 (aa 102-247) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2310032M22Rik; 2610016F04Rik; AI507524; BAF180; BRG1-associated factor 180; glutamate receptor interacting protein 2; hPB1; LOC506557 protein; PB1; PBRM1; polybromo 1; polybromo-1D; Protein polybromo-1; RGD1565549
Common Name PBRM1
Gene Symbol Pbrm1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less