missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89408

Invitrogen™ Human PAR4 (aa 215-330) Control Fragment Recombinant Protein

Catalog No. RP89408
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89408 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89408 Supplier Invitrogen™ Supplier No. RP89408

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases.

Specifications

Accession Number Q96IZ0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5074
Name Human PAR4 (aa 215-330) Control Fragment
Quantity 100 μL
Gene Alias 2310001G03Rik; coagulation factor II (thrombin) receptor-like 3; Coagulation factor II receptor-like 3; F2R like thrombin/trypsin receptor 3; F2RL3; PAR4; Par-4; par-4 induced by effectors of apoptosis; Pawr; PRKC apoptosis WT1 regulator protein; PRKC, apoptosis, WT1, regulator; pro-apoptotic WT1 regulator; prostate apoptosis response 4; prostate apoptosis response 4 protein; Prostate apoptosis response protein 4; prostate apoptosis response protein PAR-4; prostate apoptosis response-4; protease-activated receptor-4; proteinase-activated receptor 4; Thrombin receptor-like 3; transcriptional repressor PAR4; transcriptional repressor Par-4-like protein PAWR; WT1-interacting protein
Common Name PAR4
Gene Symbol Pawr
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less