missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105580

Invitrogen™ Human PAQR6 (aa 146-225) Control Fragment Recombinant Protein

Catalog No. RP105580
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105580 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105580 Supplier Invitrogen™ Supplier No. RP105580

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67298 (PA5-67298. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plasma membrane progesterone (P4) receptor coupled to G proteins (PubMed:23763432, PubMed:23161870). Seems to act through a G(s) mediated pathway (PubMed:23161870). Involved in neurosteroid inhibition of apoptosis (PubMed:23161870). May be involved in regulating rapid P4 signaling in the nervous system (PubMed:23763432). Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone (PubMed:23763432, PubMed:23161870). [UniProt]

Specifications

Accession Number Q6TCH4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79957
Name Human PAQR6 (aa 146-225) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500001B10Rik; FLJ22672; LOW QUALITY PROTEIN: membrane progestin receptor delta; LOW QUALITY PROTEIN: progestin and adipoQ receptor family member 6; Membrane progesterone P4 receptor delta; Membrane progesterone receptor delta; Membrane progestin receptor delta; MGC137682 protein; mPR delta; Paqr6; PRdelta; Progesterone and adipoQ receptor family member 6; Progestin and adipoQ receptor family member 6; progestin and adipoQ receptor family member VI; progestin and adipoQ receptor family member VI variant 3; progestin and adipoQ receptor family member VI variant 4; progestin and adipoQ receptor family member VI variant 5
Common Name PAQR6
Gene Symbol PAQR6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less