missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PACSIN2 (aa 346-399) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101143
Description
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83983 (PA5-83983. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PACSIN 2, a 486 AA phosphoprotein is a novel member of the PACSIN family of cytoplasmic adapter proteins. It is an isoform of PACSIN with a CDC15 N-terminal domain, a C-terminal SH3 domain, 3 conserved regions specific to the PACSIN family, and 3 asn-pro-phe (NPF) motifs, which potentially bind to EH domains. This protein is known to display a ubiquitous expression pattern with the highest levels of expression in brain. Reports suggest that PACSIN 2 participates in the organization of the actin cytoskeleton, the regulation of vesicular traffic. It also participates in endocytic internalization and endocytic receptor recycling.Specifications
| Q9UNF0 | |
| Blocking Assay, Control | |
| 11252 | |
| 100 μL | |
| AI197433; cytoplasmic phosphoprotein PACSIN2; Pacsin2; pacsin2.S; protein kinase C and casein kinase substrate in neurons 2; protein kinase C and casein kinase substrate in neurons 2 protein; protein kinase C and casein kinase substrate in neurons 2 S homeolog; protein kinase C and casein kinase substrate in neurons protein 2; RP3-437M21.1; SdpII; SdpIIsyndapin II; synaptic dynamin-associated protein II; syndapin 2; Syndapin II; syndapin2; syndapin-2; Syndapin-II; XELAEV_18019736mg; x-PACSIN2 | |
| PACSIN2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PACSIN2 (aa 346-399) Control Fragment | |
| RUO | |
| PACSIN2 | |
| Unconjugated | |
| Recombinant | |
| NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |