missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98799

Invitrogen™ Human PABPN1L (aa 1-53) Control Fragment Recombinant Protein

Catalog No. RP98799
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98799 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98799 Supplier Invitrogen™ Supplier No. RP98799

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60357 (PA5-60357. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Binds the poly(A) tail of mRNA.

Specifications

Accession Number A6NDY0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 390748
Name Human PABPN1L (aa 1-53) Control Fragment
Quantity 100 μL
Gene Alias embryonic poly(A) binding protein 2; embryonic poly(A)-binding protein 2; Embryonic poly(A)-binding protein type II; embryonic polyadenylate-binding protein 2; EPABP2; ePABP-2; PABPN1L; PABPNL1; poly(A) binding protein nuclear 1 like (cytoplasmic); poly(A) binding protein, nuclear 1-like (cytoplasmic); poly(A)-binding protein nuclear-like 1
Common Name PABPN1L
Gene Symbol PABPN1L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less