missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95342

Invitrogen™ Human P2X6 (aa 367-438) Control Fragment Recombinant Protein

Catalog No. RP95342
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95342 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95342 Supplier Invitrogen™ Supplier No. RP95342
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55975 (PA5-55975. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

P2rx6 encodes receptors that are members of the ligand-gated ion channel family that open in response to extracellular ATP. Each P2rx6 receptor is made up of a trimer of subunits (P2X1-7) all of which share the common structure of two transmembrane domains. The protein encoded by the P2rx6 gene belongs to the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. The P2rx6 gene is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells. Alternative splicing results in multiple transcript variants of P2rx6.

Specifications

Accession Number O15547
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9127
Name Human P2X6 (aa 367-438) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ATP receptor; P2R x 6; P2RXL1; P2X purinoceptor 6; P2 x 6; P2 x 6 receptor; P2XM; Purinergic receptor; purinergic receptor P2X 6; purinergic receptor P2X, ligand gated ion channel, 6; purinergic receptor P2X, ligand-gated ion channel, 6; purinergic receptor P2 x 6; Purinergic receptor P2X-like 1; purinergic receptor P2X-like 1 orphan receptor; purinergic receptor P2X-like 1, orphan receptor; purinoceptor P2 x 6; purinoreceptor P2 x 6; Rnap2 x 6; skeletal muscle-expressed P2X
Common Name P2X6
Gene Symbol P2RX6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQTQTPGWPCPSSDTHLPTHS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less