missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human OXCT1 (aa 22-57) Control Fragment Recombinant Protein

Catalog No. RP103726
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103726 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103726 Supplier Invitrogen™ Supplier No. RP103726

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63957 (PA5-63957. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.

Specifications

Accession Number P55809
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5019
Name Human OXCT1 (aa 22-57) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610008O03Rik; 3-oxoacid CoA transferase 1; 3-oxoacid CoA-transferase 1; 3-oxoacid-CoA transferase 1; EMBL:AAI66478.1}; OXCT; Oxct1; oxct1 {ECO:0000312; Oxct2a; SCOT; SCOT-s; somatic-type succinyl CoA:3-oxoacid CoA-transferase; somatic-type succinyl-CoA:3-oxoacid CoA-transferase; somatic-type succinyl-CoA:3-oxoacid-CoA-transferase; succinyl CoA:3-oxoacid CoA transferase; succinyl-CoA:3-ketoacid CoA transferase; succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; succinyl-CoA:3-ketoacid-CoA transferase; succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial; Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial-like protein; Unknown (protein for MGC:137519)
Common Name OXCT1
Gene Symbol OXCT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less