missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105261

Invitrogen™ Human OSR2 (aa 70-139) Control Fragment Recombinant Protein

Catalog No. RP105261
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105261 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105261 Supplier Invitrogen™ Supplier No. RP105261

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66585 (PA5-66585. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OSR2 is a mammalian homolog of the Drosophila odd-skipped family of transcription factors.

Specifications

Accession Number Q8N2R0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 116039
Name Human OSR2 (aa 70-139) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5430409I15Rik; odd-skipped related 2; odd-skipped related transciption factor 2; Osr2; Osr2A; Osr2B; Protein odd-skipped-related 2
Common Name OSR2
Gene Symbol OSR2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence THRSQELRGAAATEGFLYVLLSHWVFVGAPRPPASDSWKKGLVPSAPPASRKMGSKALPAPIPLHPSLQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less