missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91293

Invitrogen™ Human OR10J3 (aa 261-329) Control Fragment Recombinant Protein

Catalog No. RP91293
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91293 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91293 Supplier Invitrogen™ Supplier No. RP91293

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60175 (PA5-60175. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Specifications

Accession Number Q5JRS4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 441911
Name Human OR10J3 (aa 261-329) Control Fragment
Quantity 100 μL
Gene Alias Olfactory receptor 10J3; olfactory receptor family 10 subfamily J member 3; olfactory receptor OR1-25 pseudogene; olfactory receptor, family 10, subfamily J, member 3 pseudogene; OR10J3; OR10J3P; OR1-25
Common Name OR10J3
Gene Symbol OR10J3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRCSAQSRGAKNSVSLMKRGCEGFSFAFINMY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less