missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101668

Invitrogen™ Human OMA1 (aa 448-524) Control Fragment Recombinant Protein

Catalog No. RP101668
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101668 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101668 Supplier Invitrogen™ Supplier No. RP101668

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63067 (PA5-63067. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OMA1 (Overlapping with the m-AAA protease 1 homolog) is also named as MPRP1(Metalloprotease-related protein 1) and belongs to the peptidase M48 family. It is a zinc metalloprotease that spans the inner mitochondrial membrane with a number of predicted membrane spanning domains and the 60 kDa form of OMA1 rapidly accumulated concomitantly with the cleavage of all OPA1 variants, and the 40 kDa form of OMA1 may be the inactive form, with the 60 kDa form being the active enzyme.

Specifications

Accession Number Q96E52
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 115209
Name Human OMA1 (aa 448-524) Control Fragment
Quantity 100 μL
Gene Alias 2010001O09Rik; DAB1; metalloendopeptidase OMA1, mitochondrial; metalloprotease related protein 1; metalloprotease-related protein 1; MPRP1; MPRP-1; Oma1; OMA1 homolog, zinc metallopeptidase; OMA1 homolog, zinc metallopeptidase (S. cerevisiae); OMA1 zinc metallopeptidase; OMA1 zinc metallopeptidase homolog; overlapping activity with M-AAA protease; overlapping with the m-AAA protease 1 homolog; peptidase; RGD1304821; YKR087C; zinc metallopeptidase homolog; zinc metallopeptidase OMA1; ZMPOMA1
Common Name OMA1
Gene Symbol OMA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less