missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human OBP2A Control Fragment Recombinant Protein

Catalog No. RP101826
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101826 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101826 Supplier Invitrogen™ Supplier No. RP101826
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63220 (PA5-63220. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Specifications

Accession Number Q9NY56
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29991
Name Human OBP2A Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias hOBPIIa; LCN13; OBP; OBP2A; OBP2C; OBPIIa; odorant binding protein 2 A; odorant-binding protein 2 A; Odorant-binding protein IIa; putative odorant-binding protein 2 c
Common Name OBP2A
Gene Symbol OBP2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less